PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g005360.1.1
Common NameLOC101246137
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 225aa    MW: 24777.3 Da    PI: 4.2731
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g005360.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB98.36.4e-3154137287
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                         +eqd+++P  nv+rim+ + P++ kis+dak t+ +c+sefi fvt ea+ +cqre+r+ti+ +d+ w + ++Gf+dy+epl  y+
  Solyc05g005360.1.1  54 QEQDQVIP--NVARIMQSTHPSHVKISDDAKRTMYHCMSEFICFVTYEANAHCQREQRNTITVEDVDWVINKFGFDDYIEPLPYYF 137
                         57788776..************************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.7E-2754136IPR009072Histone-fold
SuperFamilySSF471139.78E-2361138IPR009072Histone-fold
PfamPF008081.8E-1762121IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MDNGNHVGGS GNGGFHSYGR SPQPTPADPP SPDTEMSLEL PAHLNQEVVE IISQEQDQVI  60
PNVARIMQST HPSHVKISDD AKRTMYHCMS EFICFVTYEA NAHCQREQRN TITVEDVDWV  120
INKFGFDDYI EPLPYYFPPN SEDDGGACGS LMRESLLKRP MVDTASSSNI TPYNVPPNFP  180
MAHHHFVYPP PMGNGDMQGE ASTSQCAGAS VDTDVESPME EDKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-2054142292Transcription factor HapC (Eurofung)
4g92_B1e-2054142292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2040820.0Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0086I08, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239342.11e-169PREDICTED: nuclear transcription factor Y subunit B-6-like isoform X1
TrEMBLK4BW671e-169K4BW67_SOLLC; Uncharacterized protein
STRINGSolyc05g005360.1.11e-168(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14016414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.27e-34nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]